PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000191614
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 528aa    MW: 60118.3 Da    PI: 6.5691
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000191614genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM224.3e-0734137494128
            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++  l    vfy+g++p+ +kt+W+mhe+++
  MDP0000191614 341 I-EQQEWILESYWVFYEGKSPRVKKTNWLMHEFNV 374
                    3.56667778889********************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.7202.9E-6540308IPR016040NAD(P)-binding domain
CDDcd053241.08E-8441312No hitNo description
SuperFamilySSF517358.92E-5541308IPR016040NAD(P)-binding domain
PRINTSPR000811.1E-184158IPR002347Short-chain dehydrogenase/reductase SDR
PfamPF001061.1E-2841180IPR002347Short-chain dehydrogenase/reductase SDR
PRINTSPR000807.4E-8115126IPR002347Short-chain dehydrogenase/reductase SDR
PRINTSPR000811.1E-18115126IPR002347Short-chain dehydrogenase/reductase SDR
PRINTSPR000807.4E-8168176IPR002347Short-chain dehydrogenase/reductase SDR
PRINTSPR000807.4E-8235254IPR002347Short-chain dehydrogenase/reductase SDR
PRINTSPR000811.1E-18235254IPR002347Short-chain dehydrogenase/reductase SDR
PRINTSPR000811.1E-18260277IPR002347Short-chain dehydrogenase/reductase SDR
SuperFamilySSF1019412.09E-5351379IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MGKSEKTERA KERREKRRQE ISLLRTIPYS DHQRWWSAET VAVVTGGNRG IGFELSKQLA  60
AHGVTVILTS RDHSVGLEAA KVFQEGGLNV FCHQLDVLDM ASIIEFCDWL KENYGGLDIL  120
INNAAVNFNQ GSDNTVEYAS QVITTNYYGT KNMIQAMIPL MKPSAAGARI VNVSSRLGRI  180
NGRRNKIDDV ILREKFSNLD RVTEELIDQT VSSFLQQVQD GTWESGGWPK TFTDYSVSKL  240
AVNTYTRLVA KMLSDRPEGQ KIYINCYCPG WVKTAMTGYA GNISAEEGAD TAVWLALLPD  300
LAITGKFFAE RPKYKLDGEE DNIGTFLHQV IKRIEKGHVQ IEQQEWILES YWVFYEGKSP  360
RVKKTNWLMH EFNVKAPPRK ADRNNMRKQP NDEVATEDNG LDYDGVDLAL QNPNEYPPKN  420
SYDNPHPQNP NHQSYLVYPP QNPNHQSYIV YPPQNPNHQS YLNSNHNGYY SCDGYNLFSN  480
TNAMGSDGLF KEEPFPTILP PQDHQHLYLP NQNSLQFNGY QPHQRLWG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wma_A4e-50413116271Carbonyl reductase [NADPH] 1
2pfg_A4e-50413116271Carbonyl reductase [NADPH] 1
3bhi_A4e-50413116271Carbonyl reductase [NADPH] 1
3bhj_A4e-50413116271Carbonyl reductase [NADPH] 1
3bhm_A4e-50413116271Carbonyl reductase [NADPH] 1
4z3d_A4e-50413116271Carbonyl reductase [NADPH] 1
4z3d_B4e-50413116271Carbonyl reductase [NADPH] 1
4z3d_C4e-50413116271Carbonyl reductase [NADPH] 1
4z3d_D4e-50413116271Carbonyl reductase [NADPH] 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356810.10.0PREDICTED: (+)-neomenthol dehydrogenase-like
TrEMBLM5WMR40.0M5WMR4_PRUPE; Uncharacterized protein
STRINGPOPTR_0012s11200.11e-172(Populus trichocarpa)